PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G423800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 539aa    MW: 57499.1 Da    PI: 6.5076
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G423800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS345.96.5e-1061645371374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvsely....kalppsetseknsseelaalklfsev 87 
                         lv+lL++cAeav+ +d ++a alL +l+  a  +g+++qR+a++f+++La rla   +        a+   ++   +   +  al l +e+
  Sevir.5G423800.1.p 164 LVQLLVACAEAVACRDRAQAAALLRELQVGAPVHGTAFQRVASCFVQGLADRLALAHPPALgpasMAFCIPPSCAGRDGARGEALALAYEL 254
                         689**************************************************9865544311002222233333336777788899**** PP

                GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelg 173
                         +P+l+f+h++aN  Ilea+ege+ vH++D++++     G QW +Ll+ La+R++ +p ++R+Tgvg+      ++++++g+ L+ +Ae lg
  Sevir.5G423800.1.p 255 CPYLRFAHFVANASILEAFEGESNVHVVDLGMTlgldRGHQWRSLLDGLAARAGAKPkRVRVTGVGA----PLDTMRAVGRELEAYAEGLG 341
                         *****************************98762222567*************66665*********....99****************** PP

                GRAS 174 vpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                         +++ef++ v ++le+l+ ++L v  +Ea+a+++vl+lh +++es    +   +vL++v++lsP+ +v+veq+a hn++ Fl rf+eal+yy
  Sevir.5G423800.1.p 342 MRLEFRA-VDRSLESLHADDLGVAADEAVAISSVLELHCVVKESRGALN---SVLQTVRKLSPRAFVLVEQDAGHNGPFFLGRFMEALHYY 428
                         *******.799******************************88877777...8************************************** PP

                GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveee 354
                         +a+fd+l+a lpr +  r+ vE++ +g ei+nvv ceg +r+erhe++ +Wr+r+++aGF++vp++    + a+  l++ + + gy+v ee
  Sevir.5G423800.1.p 429 AAVFDALDAALPRYDARRARVEQFHFGAEIRNVVGCEGVARVERHERADQWRRRMSRAGFQSVPIRMA--ARAREWLEENAgGGGYTVAEE 517
                         *****************************************************************865..567888888887999****** PP

                GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                         +g+lvlgWk++pL+++S+W+
  Sevir.5G423800.1.p 518 KGCLVLGWKGKPLIAASCWK 537
                         *******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.495138518IPR005202Transcription factor GRAS
PfamPF035142.3E-103164537IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MGMPEQPCRS TPNSFTTSFG SSQQMHHLPQ HDAALCTEPG LGFPYYYGTD QQDAAFDGDE  60
VDLGFRASKV TKVDYYSSPY QPSWPLARAD VAAAAAESSR VRKQRFRDVL ESCKQKVEAM  120
EAMESPVAFQ EGEDGGVAGD GGGAAAGGGG GGGGGGGGAD GMRLVQLLVA CAEAVACRDR  180
AQAAALLREL QVGAPVHGTA FQRVASCFVQ GLADRLALAH PPALGPASMA FCIPPSCAGR  240
DGARGEALAL AYELCPYLRF AHFVANASIL EAFEGESNVH VVDLGMTLGL DRGHQWRSLL  300
DGLAARAGAK PKRVRVTGVG APLDTMRAVG RELEAYAEGL GMRLEFRAVD RSLESLHADD  360
LGVAADEAVA ISSVLELHCV VKESRGALNS VLQTVRKLSP RAFVLVEQDA GHNGPFFLGR  420
FMEALHYYAA VFDALDAALP RYDARRARVE QFHFGAEIRN VVGCEGVARV ERHERADQWR  480
RRMSRAGFQS VPIRMAARAR EWLEENAGGG GYTVAEEKGC LVLGWKGKPL IAASCWKC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-541645374375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0037910.0AP003791.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1065G12.
GenBankAP0067570.0AP006757.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0551C06.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970957.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLK3XGD90.0K3XGD9_SETIT; Uncharacterized protein
STRINGSi000959m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56403354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.14e-71GRAS family protein